Text mining Term | P14 |
---|---|
UniProt ID | S10A9_RAT |
Name |
Calgranulin-B p14 Protein S100-A9 Myeloid-related protein 14 Migration inhibitory factor-related protein 14 S100 calcium-binding protein A9 MRP-14 |
Gene Names |
S100a9
Synonyms:Mrp14 |
Taxonomy | Rattus norvegicus |
Function |
Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro- inflammatory mediator in acute and chronic inflammation and up- regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions (By similarity). Stimulates proliferation of fibroblast cells as both a monomer and a homodimer. May act as a mitogen during chronic inflammation. |
---|---|
Subcellular location |
Secreted (By similarity). Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein (By similarity). Note=Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM- CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes (By similarity). |
GO:0005886 | plasma membrane | CC |
GO:0005737 | cytoplasm | CC |
GO:0010043 | response to zinc ion | BP |
GO:0005509 | calcium ion binding | MF |
GO:0005856 | cytoskeleton | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0045471 | response to ethanol | BP |
GO:0005615 | extracellular space | CC |
>gi|16758364|ref|NP_446039.1| protein S100-A9 [Rattus norvegicus] MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTN QDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHRHGKGCGK |
Ensembl Gene |
ENSRNOT00000015351 |
---|---|
UniGene |
Rn.6703 |
PDB | |
RefSeq |
NP_446039.1 |
Pfam |
PF01023 |