Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 HSP32 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0005829 | cytosol | CC |
GO:0042167 | heme catabolic process | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0001525 | angiogenesis | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0006644 | phospholipid metabolic process | BP |
GO:0020037 | heme binding | MF |
GO:0004630 | phospholipase D activity | MF |
GO:0005901 | caveola | CC |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0006788 | heme oxidation | BP |
GO:0019899 | enzyme binding | MF |
GO:0008219 | cell death | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0001666 | response to hypoxia | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0005730 | nucleolus | CC |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0005792 | microsome | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1ULX 3I9U 2ZVU 1VGI 3I9T 1IVJ 1DVG 1J2C 2DY5 1IX4 2E7E 1IRM 1J02 1UBB 1IX3 1DVE |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |