Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 HSP32 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0019899 | enzyme binding | MF |
GO:0005901 | caveola | CC |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0020037 | heme binding | MF |
GO:0005792 | microsome | CC |
GO:0001666 | response to hypoxia | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0006788 | heme oxidation | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0042167 | heme catabolic process | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005829 | cytosol | CC |
GO:0006644 | phospholipid metabolic process | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0008219 | cell death | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0001525 | angiogenesis | BP |
GO:0005730 | nucleolus | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
2ZVU 1J02 2DY5 3I9U 3I9T 1DVE 1J2C 1IX4 1IRM 1VGI 1IX3 1ULX 1DVG 1IVJ 2E7E 1UBB |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |