Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0006644 | phospholipid metabolic process | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0001666 | response to hypoxia | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0005730 | nucleolus | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0020037 | heme binding | MF |
GO:0005901 | caveola | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0019899 | enzyme binding | MF |
GO:0005829 | cytosol | CC |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0005792 | microsome | CC |
GO:0042167 | heme catabolic process | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0006788 | heme oxidation | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0008219 | cell death | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0001525 | angiogenesis | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IRM 1DVE 3I9U 1DVG 1J02 3I9T 1IX4 1ULX 2E7E 1J2C 1IVJ 2ZVU 1IX3 1VGI 1UBB 2DY5 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |