Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 HSP32 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0008219 | cell death | BP |
GO:0005901 | caveola | CC |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0020037 | heme binding | MF |
GO:0005730 | nucleolus | CC |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0006788 | heme oxidation | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0005792 | microsome | CC |
GO:0042167 | heme catabolic process | BP |
GO:0001525 | angiogenesis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0001666 | response to hypoxia | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0019899 | enzyme binding | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0005829 | cytosol | CC |
GO:0008217 | regulation of blood pressure | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IX3 1J2C 1DVG 2E7E 3I9T 1J02 1DVE 1IX4 1IRM 1VGI 2DY5 3I9U 2ZVU 1UBB 1ULX 1IVJ |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |