Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HSP32 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0004630 | phospholipase D activity | MF |
GO:0005730 | nucleolus | CC |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0042167 | heme catabolic process | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0005901 | caveola | CC |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0001525 | angiogenesis | BP |
GO:0005829 | cytosol | CC |
GO:0020037 | heme binding | MF |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0001666 | response to hypoxia | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0019899 | enzyme binding | MF |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0031670 | cellular response to nutrient | BP |
GO:0005792 | microsome | CC |
GO:0008219 | cell death | BP |
GO:0006788 | heme oxidation | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IX4 3I9U 1J2C 1DVG 1J02 2E7E 1IVJ 3I9T 1IRM 1ULX 2DY5 2ZVU 1DVE 1UBB 1VGI 1IX3 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |