Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HSP32 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0005829 | cytosol | CC |
GO:0006788 | heme oxidation | BP |
GO:0005730 | nucleolus | CC |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0019899 | enzyme binding | MF |
GO:0031670 | cellular response to nutrient | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0020037 | heme binding | MF |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0004630 | phospholipase D activity | MF |
GO:0006644 | phospholipid metabolic process | BP |
GO:0005792 | microsome | CC |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0001525 | angiogenesis | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0005901 | caveola | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0042167 | heme catabolic process | BP |
GO:0008219 | cell death | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1VGI 3I9U 1J02 1UBB 1IVJ 2DY5 1IX3 1IX4 1IRM 1J2C 1DVE 1ULX 2ZVU 3I9T 2E7E 1DVG |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |