| Text mining Term | Cytochrome c oxidase (protein family or complex) |
|---|---|
| UniProt ID | COX5C_IPOBA |
| Name |
Cytochrome c oxidase polypeptide Vc Cytochrome c oxidase subunit 5C |
| Gene Names |
COX5C
Synonyms:COXVC |
| Taxonomy | Ipomoea batatas |
| Function |
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. |
|---|---|
| Subcellular location |
Mitochondrion inner membrane. |
| GO:0016021 | integral to membrane | CC |
| GO:0005746 | mitochondrial respiratory chain | CC |
>gi|688313|gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas] MAGGHVAHLVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVVADEE |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |