| Text mining Term | protein is |
|---|---|
| UniProt ID | PSBJ_HORJU |
| Name |
Photosystem II reaction center protein J PSII-J |
| Gene Names |
psbJ
|
| Taxonomy | Hordeum jubatum |
| Function |
This protein is a component of the reaction center of photosystem II. |
|---|---|
| Subcellular location |
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By similarity). |
| GO:0016021 | integral to membrane | CC |
| GO:0009535 | chloroplast thylakoid membrane | CC |
| GO:0009539 | photosystem II reaction center | CC |
| GO:0015979 | photosynthesis | BP |
>gi|62287059|sp|Q6W6R2.1|PSBJ_HORJU RecName: Full=Photosystem II reaction center protein J; Short=PSII-J MADTTGRIPLWLIGTVAGIPVIGLVGVFFYGSYSGLGSSL |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF01788 |