| Text mining Term | protein is |
|---|---|
| UniProt ID | CX5C2_HELAN |
| Name |
Cytochrome c oxidase polypeptide Vc-2 Cytochrome c oxidase subunit 5C-2 |
| Gene Names |
COX5C2
|
| Taxonomy | Helianthus annuus |
| Function |
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport (By similarity). |
|---|---|
| Subcellular location |
Mitochondrion inner membrane (By similarity). |
| GO:0005746 | mitochondrial respiratory chain | CC |
| GO:0016021 | integral to membrane | CC |
>gi|48428106|sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDEE |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |