| Text mining Term | protein is |
|---|---|
| UniProt ID | PSBI_AGRST |
| Name |
Photosystem II reaction center protein I PSII 4.8 kDa protein PSII-I |
| Gene Names |
psbI
|
| Taxonomy | Agrostis stolonifera |
| Function |
This protein is a component of the reaction center of photosystem II (By similarity). |
|---|---|
| Subcellular location |
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By similarity). |
| GO:0009535 | chloroplast thylakoid membrane | CC |
| GO:0009539 | photosystem II reaction center | CC |
| GO:0016021 | integral to membrane | CC |
| GO:0015979 | photosynthesis | BP |
>gi|125980841|sp|A1E9Z2.1|PSBI_AGRST RecName: Full=Photosystem II reaction center protein I; Short=PSII-I; AltName: Full=PSII 4.8 kDa protein MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq |
YP_874720.1 |
| Pfam |
PF02532 |