| Text mining Term | protein tyrosine kinase |
|---|---|
| UniProt ID | ROR1_DROME |
| Name |
dRor Tyrosine-protein kinase transmembrane receptor Ror |
| Gene Names |
Ror
|
| Taxonomy | Drosophila melanogaster |
| Function |
Tyrosine-protein kinase receptor that functions during early stages of neuronal development. |
|---|---|
| Subcellular location |
Membrane; Single-pass type I membrane protein (Potential). |
| GO:0016021 | integral to membrane | CC |
| GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | BP |
| GO:0004714 | transmembrane receptor protein tyrosine kinase activity | MF |
| GO:0007417 | central nervous system development | BP |
| GO:0005524 | ATP binding | MF |
>gi|2648036|emb|CAA05743.1| protein tyrosine kinase [Drosophila melanogaster] CLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTES |
| Ensembl Gene | |
|---|---|
| UniGene |
Dm.4808 |
| PDB | |
| RefSeq |
NP_476962.1 |
| Pfam |
PF07714 PF00051 |