| Text mining Term | brains |
|---|---|
| UniProt ID | CORZ_GALME |
| Name |
CPRP Corazonin precursor-related peptide Crz Pro-corazonin Corazonin |
| Gene Names |
crz
|
| Taxonomy | Galleria mellonella |
| Function |
Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat (By similarity). |
|---|---|
| Subcellular location |
Corazonin: Secreted.
Corazonin precursor-related peptide: Secreted (By similarity). |
| GO:0007218 | neuropeptide signaling pathway | BP |
| GO:0005576 | extracellular region | CC |
| GO:0045823 | positive regulation of heart contraction | BP |
| GO:0005184 | neuropeptide hormone activity | MF |
>gi|51701352|sp|Q9GSA4.1|CORZ_GALME RecName: Full=Pro-corazonin; Short=Crz; Contains: RecName: Full=Corazonin; Contains: RecName: Full=Corazonin precursor-related peptide; Short=CPRP; Flags: Precursor MATNITMFLIVITLTSVAAQTFQYSRGWTNGKRDGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLN ERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |