| Text mining Term | ribosomal protein (protein family or complex) |
|---|---|
| UniProt ID | RMAR_VANPO |
| Name |
Ribosomal protein VAR1, mitochondrial |
| Gene Names |
VAR1
|
| Taxonomy | Vanderwaltozyma polyspora DSM 70294 |
| Function |
Essential for mitochondrial protein synthesis and required for the maturation of small ribosomal subunits (By similarity). |
|---|---|
| Subcellular location |
Mitochondrion. |
| GO:0005761 | mitochondrial ribosome | CC |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0006412 | translation | BP |
>gi|150456413|ref|YP_001331021.1| ribosomal protein [Vanderwaltozyma polyspora] MVFYMYNMMMNLNLLKEMRTNNKLVLNKLVLKNLLYWINKDTFKENMKIYSNYNNNYMNTNLQ |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF05316 |