Text mining Term | muscles |
---|---|
UniProt ID | AKH2_SCHGR |
Name |
Adipokinetic hormone precursor-related peptide beta chain APRP-beta Adipokinetic hormone II Adipokinetic hormone 2 AKH-II Adipokinetic prohormone type 2 |
Gene Names |
|
Taxonomy | Schistocerca gregaria |
Function |
This hormone, released from cells in the corpora cardiaca after the beginning of flight, causes release of diglycerides from the fat body and then stimulates the flight muscles to use these diglycerides as an energy source. |
---|---|
Subcellular location |
Secreted. |
GO:0007629 | flight behavior | BP |
GO:0007218 | neuropeptide signaling pathway | BP |
GO:0005179 | hormone activity | MF |
GO:0005576 | extracellular region | CC |
>gi|543790|sp|P35808.1|AKH2_SCHGR RecName: Full=Adipokinetic prohormone type 2; Contains: RecName: Full=Adipokinetic hormone 2; AltName: Full=Adipokinetic hormone II; Short=AKH-II; Contains: RecName: Full=Adipokinetic hormone precursor-related peptide beta chain; Short=APRP-beta; Flags: Precursor QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF06377 |