H ras

General Information (Source: NCBI Gene,UniProt)

Text mining Term H ras
UniProt ID RAS1_DROME
Name Ras-like protein 1
Dmras85D
Dras1
Gene Names Ras85D
Synonyms:Ras1
Taxonomy Drosophila melanogaster

General annotation

Function May mediate a signal that determines the fate of photoreceptor cells in the developing compound eye. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Subcellular location Cell membrane; Lipid-anchor; Cytoplasmic side. Note=Loss of prenylation causes protein location to the cytoplasm.

Gene Ontology

GO:0008284 positive regulation of cell proliferation BP
GO:0007391 dorsal closure BP
GO:0048863 stem cell differentiation BP
GO:0003924 GTPase activity MF
GO:0072089 stem cell proliferation BP
GO:0007369 gastrulation BP
GO:0007455 eye-antennal disc morphogenesis BP
GO:0030381 chorion-containing eggshell pattern formation BP
GO:0007426 tracheal outgrowth, open tracheal system BP
GO:0072002 Malpighian tubule development BP
GO:0008293 torso signaling pathway BP
GO:0001708 cell fate specification BP
GO:0046673 negative regulation of compound eye retinal cell programmed cell death BP
GO:0007298 border follicle cell migration BP
GO:0006916 anti-apoptosis BP
GO:0008595 anterior/posterior axis specification, embryo BP
GO:0007309 oocyte axis specification BP
GO:0016049 cell growth BP
GO:0045500 sevenless signaling pathway BP
GO:0007264 small GTPase mediated signal transduction BP
GO:0007422 peripheral nervous system development BP
GO:0002168 instar larval development BP
GO:0046534 positive regulation of photoreceptor cell differentiation BP
GO:0007428 primary branching, open tracheal system BP
GO:0006606 protein import into nucleus BP
GO:0035099 hemocyte migration BP
GO:0045610 regulation of hemocyte differentiation BP
GO:0040014 regulation of multicellular organism growth BP
GO:0030307 positive regulation of cell growth BP
GO:0007476 imaginal disc-derived wing morphogenesis BP
GO:0035088 establishment or maintenance of apical/basal cell polarity BP
GO:0005525 GTP binding MF
GO:0000082 G1/S transition of mitotic cell cycle BP
GO:0007507 heart development BP
GO:0008361 regulation of cell size BP
GO:0005886 plasma membrane CC

Sequence

>gi|131859|sp|P08646.2|RAS1_DROME RecName: Full=Ras-like protein 1; Short=Dras1; AltName: Full=Dmras85D; Flags: Precursor
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ
YMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIP
YIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Dm.4812
PDB
RefSeq NP_476699.1
Pfam PF00071