| Text mining Term | Cytochrome c oxidase (protein family or complex) |
|---|---|
| UniProt ID | Q5KE02_CRYNJ |
| Name |
Cytochrome c oxidase subunit 7A Cytochrome c oxidase polypeptide VIIA |
| Gene Names |
|
| Taxonomy | Cryptococcus neoformans var. neoformans JEC21 |
| Function |
This small integral protein plays a role in holoenzyme assembly or stability (By similarity). |
|---|---|
| Subcellular location |
Mitochondrion inner membrane (By similarity). ----------------------------------------------------------------------- Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License ----------------------------------------------------------------------- |
| GO:0005746 | mitochondrial respiratory chain | CC |
| GO:0004129 | cytochrome-c oxidase activity | MF |
| GO:0022904 | respiratory electron transport chain | BP |
>gi|58269546|ref|XP_571929.1| cytochrome-c oxidase [Cryptococcus neoformans var. neoformans JEC21] MPVAPVVGKLRKRLITDLTASIGIGLAGAYTFWYTVHLPMVKRRDDYYLRLEQAKSS |
| Ensembl Gene | |
|---|---|
| UniGene |
Fne.7380 |
| PDB | |
| RefSeq |
XP_571929.1 |
| Pfam |