5 HT2B

General Information (Source: NCBI Gene,UniProt)

Text mining Term 5 HT2B
UniProt ID 5HT2B_RAT
Name 5-HT2B
5-HT-2F
Serotonin receptor 2B
Stomach fundus serotonin receptor
5-HT-2B
5-hydroxytryptamine receptor 2B
Gene Names Htr2b
Synonyms:Srl
Taxonomy Rattus norvegicus

General annotation

Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular location Cell membrane; Multi-pass membrane protein.

Gene Ontology

GO:0001819 positive regulation of cytokine production BP
GO:0051000 positive regulation of nitric-oxide synthase activity BP
GO:0042493 response to drug BP
GO:0019722 calcium-mediated signaling BP
GO:0048598 embryonic morphogenesis BP
GO:0071277 cellular response to calcium ion BP
GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB cascade BP
GO:0071502 cellular response to temperature stimulus BP
GO:0070528 protein kinase C signaling cascade BP
GO:0005737 cytoplasm CC
GO:0005886 plasma membrane CC
GO:0050715 positive regulation of cytokine secretion BP
GO:0043066 negative regulation of apoptotic process BP
GO:0070371 ERK1 and ERK2 cascade BP
GO:0005099 Ras GTPase activator activity MF
GO:0005262 calcium channel activity MF
GO:0016021 integral to membrane CC
GO:0003007 heart morphogenesis BP
GO:0051378 serotonin binding MF
GO:0042310 vasoconstriction BP
GO:0008144 drug binding MF
GO:0050795 regulation of behavior BP
GO:0014827 intestine smooth muscle contraction BP
GO:0001755 neural crest cell migration BP
GO:0051781 positive regulation of cell division BP
GO:0002031 G-protein coupled receptor internalization BP
GO:0006661 phosphatidylinositol biosynthetic process BP
GO:0001965 G-protein alpha-subunit binding MF
GO:0004435 phosphatidylinositol phospholipase C activity MF
GO:0007205 activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway BP
GO:0003300 cardiac muscle hypertrophy BP
GO:0001938 positive regulation of endothelial cell proliferation BP
GO:0006182 cGMP biosynthetic process BP
GO:0051209 release of sequestered calcium ion into cytosol BP
GO:0004993 serotonin receptor activity MF
GO:0016310 phosphorylation BP
GO:0010507 negative regulation of autophagy BP
GO:0014065 phosphatidylinositol 3-kinase cascade BP

Sequence

>gi|8393586|ref|NP_058946.1| 5-hydroxytryptamine receptor 2B [Rattus norvegicus]
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLIFAVIIPTIGG
NILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATWPLPLALCPAWLFLDVLFSTA
SIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWLISIGIAIPVPIKGIEADVVNAHNITCELTK
DRFGSFMLFGSLAAFFAPLTIMIVTYFLTIHALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKM
VMLDGSHKDKILPNSTDETLMRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCD
SCNQTTLKTLLQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Rn.10425
PDB
RefSeq NP_058946.1
Pfam PF00001