Text mining Term | 5 HT2B |
---|---|
UniProt ID | 5HT2B_RAT |
Name |
5-hydroxytryptamine receptor 2B Stomach fundus serotonin receptor Serotonin receptor 2B 5-HT-2F 5-HT2B 5-HT-2B |
Gene Names |
Htr2b
Synonyms:Srl |
Taxonomy | Rattus norvegicus |
Function |
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. |
---|---|
Subcellular location |
Cell membrane; Multi-pass membrane protein. |
GO:0010507 | negative regulation of autophagy | BP |
GO:0006182 | cGMP biosynthetic process | BP |
GO:0001755 | neural crest cell migration | BP |
GO:0070371 | ERK1 and ERK2 cascade | BP |
GO:0014065 | phosphatidylinositol 3-kinase cascade | BP |
GO:0008144 | drug binding | MF |
GO:0051000 | positive regulation of nitric-oxide synthase activity | BP |
GO:0051209 | release of sequestered calcium ion into cytosol | BP |
GO:0043066 | negative regulation of apoptotic process | BP |
GO:0005737 | cytoplasm | CC |
GO:0019722 | calcium-mediated signaling | BP |
GO:0051781 | positive regulation of cell division | BP |
GO:0042310 | vasoconstriction | BP |
GO:0042493 | response to drug | BP |
GO:0050795 | regulation of behavior | BP |
GO:0016310 | phosphorylation | BP |
GO:0050715 | positive regulation of cytokine secretion | BP |
GO:0005099 | Ras GTPase activator activity | MF |
GO:0006661 | phosphatidylinositol biosynthetic process | BP |
GO:0071502 | cellular response to temperature stimulus | BP |
GO:0005886 | plasma membrane | CC |
GO:0051378 | serotonin binding | MF |
GO:0004993 | serotonin receptor activity | MF |
GO:0007205 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | BP |
GO:0004435 | phosphatidylinositol phospholipase C activity | MF |
GO:0014827 | intestine smooth muscle contraction | BP |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | BP |
GO:0001938 | positive regulation of endothelial cell proliferation | BP |
GO:0071277 | cellular response to calcium ion | BP |
GO:0002031 | G-protein coupled receptor internalization | BP |
GO:0005262 | calcium channel activity | MF |
GO:0048598 | embryonic morphogenesis | BP |
GO:0001819 | positive regulation of cytokine production | BP |
GO:0016021 | integral to membrane | CC |
GO:0001965 | G-protein alpha-subunit binding | MF |
GO:0003300 | cardiac muscle hypertrophy | BP |
GO:0070528 | protein kinase C signaling cascade | BP |
GO:0003007 | heart morphogenesis | BP |
>gi|8393586|ref|NP_058946.1| 5-hydroxytryptamine receptor 2B [Rattus norvegicus] MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLIFAVIIPTIGG NILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATWPLPLALCPAWLFLDVLFSTA SIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWLISIGIAIPVPIKGIEADVVNAHNITCELTK DRFGSFMLFGSLAAFFAPLTIMIVTYFLTIHALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKM VMLDGSHKDKILPNSTDETLMRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCD SCNQTTLKTLLQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI |
Ensembl Gene | |
---|---|
UniGene |
Rn.10425 |
PDB | |
RefSeq |
NP_058946.1 |
Pfam |
PF00001 |