nNOS

General Information (Source: NCBI Gene,UniProt)

Text mining Term	nNOS
UniProt ID	NOS1_RAT
Name	Constitutive NOS N-NOS Neuronal NOS NOS type I BNOS nNOS Peptidyl-cysteine S-nitrosylase NOS1 NC-NOS Nitric oxide synthase, brain
Gene Names	Nos1 Synonyms:Bnos
Taxonomy	Rattus norvegicus

General annotation

Function	Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Inhibitory transmitter for non-adrenergic and non-cholinergic nerves in the colorectum. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. Inhibitory transmitter for non- adrenergic and non-cholinergic nerves in the colorectum.
Subcellular location	Cell membrane, sarcolemma; Peripheral membrane protein (By similarity). Cell projection, dendritic spine (By similarity). Note=In skeletal muscle, it is localized beneath the sarcolemma of fast-twitch muscle fiber by associating with the dystrophin glycoprotein complex (By similarity). In neurons, enriched in dendritic spines.

Function

Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Inhibitory transmitter for non-adrenergic and non-cholinergic nerves in the colorectum. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. Inhibitory transmitter for non- adrenergic and non-cholinergic nerves in the colorectum.

Subcellular location

Cell membrane, sarcolemma; Peripheral membrane protein (By similarity). Cell projection, dendritic spine (By similarity). Note=In skeletal muscle, it is localized beneath the sarcolemma of fast-twitch muscle fiber by associating with the dystrophin glycoprotein complex (By similarity). In neurons, enriched in dendritic spines.

Gene Ontology

GO:0010243	response to organic nitrogen	BP
GO:0005741	mitochondrial outer membrane	CC
GO:0005516	calmodulin binding	MF
GO:0045776	negative regulation of blood pressure	BP
GO:0051930	regulation of sensory perception of pain	BP
GO:0042383	sarcolemma	CC
GO:0009408	response to heat	BP
GO:0007565	female pregnancy	BP
GO:0007568	aging	BP
GO:0048471	perinuclear region of cytoplasm	CC
GO:0006527	arginine catabolic process	BP
GO:0045202	synapse	CC
GO:0033197	response to vitamin E	BP
GO:0043197	dendritic spine	CC
GO:0004517	nitric-oxide synthase activity	MF
GO:0006809	nitric oxide biosynthetic process	BP
GO:0005829	cytosol	CC
GO:0001917	photoreceptor inner segment	CC
GO:0043627	response to estrogen stimulus	BP
GO:0050661	NADP binding	MF
GO:0005625	soluble fraction	CC
GO:0050660	flavin adenine dinucleotide binding	MF
GO:0042803	protein homodimerization activity	MF
GO:0010288	response to lead ion	BP
GO:0046676	negative regulation of insulin secretion	BP
GO:0014823	response to activity	BP
GO:0071731	response to nitric oxide	BP
GO:0043066	negative regulation of apoptotic process	BP
GO:0035094	response to nicotine	BP
GO:0016597	amino acid binding	MF
GO:0019899	enzyme binding	MF
GO:0005624	membrane fraction	CC
GO:0031965	nuclear membrane	CC
GO:0032496	response to lipopolysaccharide	BP
GO:0010181	FMN binding	MF
GO:0020037	heme binding	MF
GO:0042582	azurophil granule	CC
GO:0045909	positive regulation of vasodilation	BP
GO:0043434	response to peptide hormone stimulus	BP
GO:0045822	negative regulation of heart contraction	BP
GO:0045471	response to ethanol	BP
GO:0012506	vesicle membrane	CC
GO:0001666	response to hypoxia	BP
GO:0046870	cadmium ion binding	MF

Sequence

>gi|16258811|ref|NP_434686.1| nitric oxide synthase, brain [Rattus norvegicus]
MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDR
PLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPS
ASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAIDPTMKSTKANLQDIGEHDELLKEIEPVLSI
LNSGSKATNRGGPAKAEMKDTGIQVDRDLDGKSHKAPPLGGDNDRVFNDLWGKDNVPVVLNNPYSEKEQS
PTSGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRT
KDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDG
STLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLK
WYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQAL
VEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRL
TPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYA
KTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKY
PEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLAN
VRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGD
DVNIEKANNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVR
LHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLP
PCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSI
QMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPC
FVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREET
LQAKNKGVFRELYTVYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIM
TQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS

Database Cross Reference

Ensembl Gene
UniGene	Rn.10573
PDB	3N6B 1M00 3SVQ 1QW6 3NLX 3JX5 1K2R 3SVP 1QAU 1MMV 3JX4 2G6I 3N2R 1MMW 1K2U 3NLM 1OM4 1K2T 1QWC 1P6K 3N68 1RS7 1ZVI 3N60 1RS6 3NLQ 1P6H 3JWV 3NLR 1ZZU 2HX3 3JT4 1F20 3NLJ 3NLY 3JT3 3NLK 3DQR 3PNF 3HSO 3N6G 3B3M 1LZX 3NLV 3N6E 3JWT 3N63 3Q9A 3B3N 3JTA 3N64 3JT5 3N67 2G6J 3B3O 3NNZ 3NLW 3HSN 3FC5 3JX1 1B8Q 1K2S 3NLP 2G6H 3HSP 3N5V 3N66 3N5Z 1P6J 3PNG 3NLN 3JT8 3N5W 2G6M 3N65 3N6A 2G6N 1P6I 3JX0 3N6C 3Q99 1ZZQ 3JWU 1CMI 3NM0 1ZVL 3N5X 3N62 3NNY 3N6F 3N69 2HX4 3JX3 3NLO 3PNE 1TLL 1ZZR 3JT9 3N6D 3JWS 3B3P 3N61 1OM5 3JX2 1VAG 3NLZ 2G6L 1LZZ 1QAV 2G6K 3JX6 3JT7 3JT6 3N5Y
RefSeq	NP_434686.1
Pfam	PF00595 PF00258 PF02898 PF00667 PF00175

PTID

nNOS

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference