| Text mining Term | glyceraldehyde 3 phosphate dehydrogenase |
|---|---|
| UniProt ID | G3P_MOUSE |
| Name |
GAPDH Peptidyl-cysteine S-nitrosylase GAPDH Glyceraldehyde-3-phosphate dehydrogenase |
| Gene Names |
Gapdh
Synonyms:Gapd |
| Taxonomy | Mus musculus |
| Function |
Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3- phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Also participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S- nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity). |
|---|---|
| Subcellular location |
Cytoplasm, cytosol (By similarity). Nucleus (By similarity). Note=Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). |
| GO:0006096 | glycolysis | BP |
| GO:0035606 | peptidyl-cysteine S-trans-nitrosylation | BP |
| GO:0005829 | cytosol | CC |
| GO:0050661 | NADP binding | MF |
| GO:0050821 | protein stabilization | BP |
| GO:0005515 | protein binding | MF |
| GO:0005634 | nucleus | CC |
| GO:0051402 | neuron apoptosis | BP |
| GO:0035605 | peptidyl-cysteine S-nitrosylase activity | MF |
| GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | MF |
| GO:0051287 | NAD binding | MF |
>gi|6679937|ref|NP_032110.1| glyceraldehyde-3-phosphate dehydrogenase [Mus musculus] MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGK PITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDN SLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTG AAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVV SCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE |