Text mining Term | glyceraldehyde 3 phosphate dehydrogenase |
---|---|
UniProt ID | G3P_RAT |
Name |
GAPDH Peptidyl-cysteine S-nitrosylase GAPDH BARS-38 38 kDa BFA-dependent ADP-ribosylation substrate Glyceraldehyde-3-phosphate dehydrogenase |
Gene Names |
Gapdh
Synonyms:Gapd |
Taxonomy | Rattus norvegicus |
Function |
Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3- phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Also participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S- nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. |
---|---|
Subcellular location |
Cytoplasm, cytosol. Nucleus. Note=Translocates to the nucleus following S-nitrosylation and interaction with SIAH1, which contains a nuclear localization signal. |
GO:0060359 | response to ammonium ion | BP |
GO:0006096 | glycolysis | BP |
GO:0005515 | protein binding | MF |
GO:0051402 | neuron apoptosis | BP |
GO:0050661 | NADP binding | MF |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | MF |
GO:0051287 | NAD binding | MF |
GO:0005829 | cytosol | CC |
GO:0050821 | protein stabilization | BP |
GO:0005625 | soluble fraction | CC |
GO:0005634 | nucleus | CC |
GO:0006094 | gluconeogenesis | BP |
GO:0035606 | peptidyl-cysteine S-trans-nitrosylation | BP |
GO:0035605 | peptidyl-cysteine S-nitrosylase activity | MF |
>gi|8393418|ref|NP_058704.1| glyceraldehyde-3-phosphate dehydrogenase [Rattus norvegicus] MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGK PITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDN SLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTG AAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVV SCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE |
Ensembl Gene |
ENSRNOT00000050443 |
---|---|
UniGene |
Rn.91450 Rn.129558 |
PDB | |
RefSeq |
NP_058704.1 XP_002726600.1 XP_001062726.1 |
Pfam |
PF00044 PF02800 |