Text mining Term | thioredoxin reductase |
---|---|
UniProt ID | PRDX2_MOUSE |
Name |
TSA Thiol-specific antioxidant protein Thioredoxin-dependent peroxide reductase 1 Peroxiredoxin-2 Thioredoxin peroxidase 1 |
Gene Names |
Prdx2
|
Taxonomy | Mus musculus |
Function |
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |
---|---|
Subcellular location |
Cytoplasm. |
GO:0005515 | protein binding | MF |
GO:0008379 | thioredoxin peroxidase activity | MF |
GO:0042744 | hydrogen peroxide catabolic process | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0008430 | selenium binding | MF |
GO:0045581 | negative regulation of T cell differentiation | BP |
GO:0048538 | thymus development | BP |
GO:0019430 | removal of superoxide radicals | BP |
GO:2000378 | negative regulation of reactive oxygen species metabolic process | BP |
GO:0000187 | activation of MAPK activity | BP |
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | BP |
GO:0042098 | T cell proliferation | BP |
GO:0030194 | positive regulation of blood coagulation | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0048872 | homeostasis of number of cells | BP |
GO:0002536 | respiratory burst involved in inflammatory response | BP |
GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway | BP |
GO:0005739 | mitochondrion | CC |
GO:0010310 | regulation of hydrogen peroxide metabolic process | BP |
>gi|148747558|ref|NP_035693.3| peroxiredoxin-2 [Mus musculus] MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Ensembl Gene |
ENSMUST00000164807 ENSMUST00000109734 ENSMUST00000109733 ENSMUST00000005292 |
---|---|
UniGene |
Mm.347009 Mm.393373 |
PDB | |
RefSeq |
NP_035693.3 |
Pfam |
PF10417 PF00578 |