tumor necrosis factor

General Information (Source: NCBI Gene,UniProt)

Text mining Term tumor necrosis factor
UniProt ID Q3U593_MOUSE
Name Tumor necrosis factor alpha
Tumor necrosis factor, isoform CRA_b
Tumor necrosis factor
Gene Names Tnf
Synonyms:TNFA
Taxonomy Mus musculus

General annotation

Function
Subcellular location

Gene Ontology

GO:0005615 extracellular space CC
GO:0033209 tumor necrosis factor-mediated signaling pathway BP
GO:0009887 organ morphogenesis BP
GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB cascade BP
GO:0005887 integral to plasma membrane CC
GO:0046330 positive regulation of JNK cascade BP
GO:0060693 regulation of branching involved in salivary gland morphogenesis BP
GO:0005125 cytokine activity MF
GO:0030198 extracellular matrix organization BP
GO:0051897 positive regulation of protein kinase B signaling cascade BP
GO:0006927 transformed cell apoptosis BP
GO:0032729 positive regulation of interferon-gamma production BP
GO:0045944 positive regulation of transcription from RNA polymerase II promoter BP
GO:0044130 negative regulation of growth of symbiont in host BP
GO:0050830 defense response to Gram-positive bacterium BP
GO:0046325 negative regulation of glucose import BP
GO:0051023 regulation of immunoglobulin secretion BP
GO:0002925 positive regulation of humoral immune response mediated by circulating immunoglobulin BP
GO:0045994 positive regulation of translational initiation by iron BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0060664 epithelial cell proliferation involved in salivary gland morphogenesis BP
GO:0006959 humoral immune response BP
GO:0002876 positive regulation of chronic inflammatory response to antigenic stimulus BP
GO:0005164 tumor necrosis factor receptor binding MF
GO:0008625 induction of apoptosis via death domain receptors BP
GO:0071230 cellular response to amino acid stimulus BP
GO:0030141 secretory granule CC
GO:0032755 positive regulation of interleukin-6 production BP
GO:0006006 glucose metabolic process BP
GO:0007254 JNK cascade BP

Sequence

>gi|7305585|ref|NP_038721.1| tumor necrosis factor [Mus musculus]
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPL
ISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQ
VLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQL
SAEVNLPKYLDFAESGQVYFGVIAL

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Mm.1293
PDB
RefSeq NP_038721.1
Pfam PF00229