Text mining Term | interferon gamma |
---|---|
UniProt ID | IFNG_RAT |
Name |
IFN-gamma Interferon gamma |
Gene Names |
Ifng
|
Taxonomy | Rattus norvegicus |
Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
---|---|
Subcellular location |
Secreted. |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | BP |
GO:0045785 | positive regulation of cell adhesion | BP |
GO:0002053 | positive regulation of mesenchymal cell proliferation | BP |
GO:0005133 | interferon-gamma receptor binding | MF |
GO:0003340 | negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis | BP |
GO:0042493 | response to drug | BP |
GO:0072308 | negative regulation of metanephric nephron tubule epithelial cell differentiation | BP |
GO:0009615 | response to virus | BP |
GO:0002026 | regulation of the force of heart contraction | BP |
GO:0045666 | positive regulation of neuron differentiation | BP |
GO:0005125 | cytokine activity | MF |
GO:0005615 | extracellular space | CC |
GO:0042511 | positive regulation of tyrosine phosphorylation of Stat1 protein | BP |
GO:0032224 | positive regulation of synaptic transmission, cholinergic | BP |
GO:0033141 | positive regulation of peptidyl-serine phosphorylation of STAT protein | BP |
>gi|20302055|ref|NP_620235.1| interferon gamma precursor [Rattus norvegicus] MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQ IISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIH QLSPESSLRKRKRSRC |
Ensembl Gene |
ENSRNOT00000009919 |
---|---|
UniGene |
Rn.10795 |
PDB | |
RefSeq |
NP_620235.1 |
Pfam |
PF00714 |