P25

General Information (Source: NCBI Gene,UniProt)

Text mining Term P25
UniProt ID NGAL_RAT
Name Lipocalin-2
Neutrophil gelatinase-associated lipocalin
Alpha-2-microglobulin-related protein
NGAL
p25
Alpha-2U globulin-related protein
Gene Names Lcn2
Taxonomy Rattus norvegicus

General annotation

Function Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5- DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth (By similarity).
Subcellular location Secreted (By similarity). Note=Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (By similarity).

Gene Ontology

GO:0042981 regulation of apoptotic process BP
GO:0005215 transporter activity MF
GO:0042803 protein homodimerization activity MF
GO:0031669 cellular response to nutrient levels BP
GO:0042493 response to drug BP
GO:0031346 positive regulation of cell projection organization BP
GO:0071356 cellular response to tumor necrosis factor BP
GO:0015891 siderophore transport BP
GO:0010628 positive regulation of gene expression BP
GO:0005829 cytosol CC
GO:0006915 apoptotic process BP
GO:0005615 extracellular space CC
GO:0071222 cellular response to lipopolysaccharide BP
GO:0071347 cellular response to interleukin-1 BP
GO:0009635 response to herbicide BP
GO:0070207 protein homotrimerization BP
GO:0005506 iron ion binding MF
GO:0070301 cellular response to hydrogen peroxide BP
GO:0002020 protease binding MF
GO:0045087 innate immune response BP

Sequence

>gi|18543345|ref|NP_570097.1| neutrophil gelatinase-associated lipocalin precursor [Rattus norvegicus]
MGLGVLCLALVLLGVLQRQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFT
MYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAM
VFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000018776
UniGene Rn.11303
PDB 2K23
RefSeq NP_570097.1
Pfam PF00061