NK 1 receptor

General Information (Source: NCBI Gene,UniProt)

Text mining Term NK 1 receptor
UniProt ID NK1R_RAT
Name SPR
NK-1R
Tachykinin receptor 1
NK-1 receptor
Substance-P receptor
Gene Names Tacr1
Synonyms:Tac1r
Taxonomy Rattus norvegicus

General annotation

Function This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K.
Subcellular location Cell membrane; Multi-pass membrane protein.

Gene Ontology

GO:0008306 associative learning BP
GO:0046887 positive regulation of hormone secretion BP
GO:0005624 membrane fraction CC
GO:0010193 response to ozone BP
GO:0014910 regulation of smooth muscle cell migration BP
GO:0009408 response to heat BP
GO:0016021 integral to membrane CC
GO:0035094 response to nicotine BP
GO:0032230 positive regulation of synaptic transmission, GABAergic BP
GO:0050671 positive regulation of lymphocyte proliferation BP
GO:0007616 long-term memory BP
GO:0005886 plasma membrane CC
GO:0009986 cell surface CC
GO:0010996 response to auditory stimulus BP
GO:0016496 substance P receptor activity MF
GO:0042755 eating behavior BP
GO:0035815 positive regulation of renal sodium excretion BP
GO:0045907 positive regulation of vasoconstriction BP
GO:0042713 sperm ejaculation BP
GO:0032570 response to progesterone stimulus BP
GO:0046878 positive regulation of saliva secretion BP
GO:0032355 response to estradiol stimulus BP
GO:0002118 aggressive behavior BP
GO:0044297 cell body CC
GO:0005737 cytoplasm CC
GO:0007204 elevation of cytosolic calcium ion concentration BP
GO:0045471 response to ethanol BP
GO:0035106 operant conditioning BP
GO:0060083 smooth muscle contraction involved in micturition BP
GO:0048266 behavioral response to pain BP
GO:0002687 positive regulation of leukocyte migration BP
GO:0051496 positive regulation of stress fiber assembly BP
GO:0048660 regulation of smooth muscle cell proliferation BP
GO:0050679 positive regulation of epithelial cell proliferation BP
GO:0045760 positive regulation of action potential BP
GO:0032224 positive regulation of synaptic transmission, cholinergic BP
GO:0019233 sensory perception of pain BP
GO:0043278 response to morphine BP
GO:0045777 positive regulation of blood pressure BP
GO:0030425 dendrite CC
GO:0070474 positive regulation of uterine smooth muscle contraction BP
GO:0003051 angiotensin-mediated drinking behavior BP
GO:0043117 positive regulation of vascular permeability BP
GO:0010634 positive regulation of epithelial cell migration BP
GO:0002526 acute inflammatory response BP

Sequence

>gi|6981628|ref|NP_036799.1| substance-P receptor [Rattus norvegicus]
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAHKRMRTVTNYF
LVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASIYSMTAVAFDRYMAIIHPLQP
RLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNRTYEKAYHICVTVLIYFLPLL
VIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLK
KFIQQVYLASMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYK
VSRLETTISTVVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000007984
UniGene Rn.89609
PDB
RefSeq NP_036799.1
Pfam PF00001