| Text mining Term | interleukin 2 |
|---|---|
| UniProt ID | IL2_MOUSE |
| Name |
Interleukin-2 IL-2 T-cell growth factor TCGF |
| Gene Names |
Il2
|
| Taxonomy | Mus musculus |
| Function |
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells. |
|---|---|
| Subcellular location |
Secreted. |
| GO:0005125 | cytokine activity | MF |
| GO:0008083 | growth factor activity | MF |
| GO:0050672 | negative regulation of lymphocyte proliferation | BP |
| GO:0005615 | extracellular space | CC |
| GO:0051024 | positive regulation of immunoglobulin secretion | BP |
| GO:0050728 | negative regulation of inflammatory response | BP |
| GO:0006955 | immune response | BP |
| GO:0048304 | positive regulation of isotype switching to IgG isotypes | BP |
| GO:0042523 | positive regulation of tyrosine phosphorylation of Stat5 protein | BP |
| GO:0046013 | regulation of T cell homeostatic proliferation | BP |
| GO:0005134 | interleukin-2 receptor binding | MF |
| GO:0042104 | positive regulation of activated T cell proliferation | BP |
| GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
>gi|7110653|ref|NP_032392.1| interleukin-2 precursor [Mus musculus] MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFEC QFDDESATVVDFLRRWIAFCQSIISTSPQ |
| Ensembl Gene |
ENSMUST00000029275 |
|---|---|
| UniGene |
Mm.14190 |
| PDB | |
| RefSeq |
NP_032392.1 |
| Pfam |
PF00715 |