Text mining Term | cystatin C |
---|---|
UniProt ID | CYTC_RAT |
Name |
Cystatin-3 Cystatin-C |
Gene Names |
Cst3
|
Taxonomy | Rattus norvegicus |
Function |
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. Known to inhibits cathepsin B, H, and L. |
---|---|
Subcellular location |
Secreted. |
GO:0031982 | vesicle | CC |
GO:0048678 | response to axon injury | BP |
GO:0001775 | cell activation | BP |
GO:0005764 | lysosome | CC |
GO:0060548 | negative regulation of cell death | BP |
GO:0009743 | response to carbohydrate stimulus | BP |
GO:0001654 | eye development | BP |
GO:0004869 | cysteine-type endopeptidase inhibitor activity | MF |
GO:0005604 | basement membrane | CC |
GO:0005615 | extracellular space | CC |
GO:0042493 | response to drug | BP |
GO:0007420 | brain development | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0014070 | response to organic cyclic compound | BP |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0007431 | salivary gland development | BP |
GO:0001666 | response to hypoxia | BP |
GO:0043025 | neuronal cell body | CC |
GO:0048471 | perinuclear region of cytoplasm | CC |
GO:0043292 | contractile fiber | CC |
GO:0002020 | protease binding | MF |
GO:0033267 | axon part | CC |
GO:0006915 | apoptotic process | BP |
GO:0043067 | regulation of programmed cell death | BP |
GO:0009636 | response to toxin | BP |
GO:0031965 | nuclear membrane | CC |
GO:0005771 | multivesicular body | CC |
GO:0070301 | cellular response to hydrogen peroxide | BP |
GO:0007566 | embryo implantation | BP |
GO:0045740 | positive regulation of DNA replication | BP |
GO:0031667 | response to nutrient levels | BP |
GO:0032355 | response to estradiol stimulus | BP |
GO:0042747 | circadian sleep/wake cycle, REM sleep | BP |
GO:0060009 | Sertoli cell development | BP |
>gi|54234046|ref|NP_036969.1| cystatin-C precursor [Rattus norvegicus] MASPLRSLMLLLAVLAVAWAGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA |
Ensembl Gene |
ENSRNOT00000007175 |
---|---|
UniGene |
Rn.106351 |
PDB | |
RefSeq |
NP_036969.1 |
Pfam |
PF00031 |