Text mining Term | osteocalcin |
---|---|
UniProt ID | OSTCN_RAT |
Name |
Gamma-carboxyglutamic acid-containing protein Bone Gla protein BGP Osteocalcin |
Gene Names |
Bglap
Synonyms:Bglap2 |
Taxonomy | Rattus norvegicus |
Function |
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. |
---|---|
Subcellular location |
Secreted. |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0009629 | response to gravity | BP |
GO:0030500 | regulation of bone mineralization | BP |
GO:0071363 | cellular response to growth factor stimulus | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0005509 | calcium ion binding | MF |
GO:0042493 | response to drug | BP |
GO:0031214 | biomineral tissue development | BP |
GO:0005615 | extracellular space | CC |
GO:0060348 | bone development | BP |
GO:0005791 | rough endoplasmic reticulum | CC |
GO:0042476 | odontogenesis | BP |
GO:0071305 | cellular response to vitamin D | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0002076 | osteoblast development | BP |
GO:0014823 | response to activity | BP |
GO:0009612 | response to mechanical stimulus | BP |
GO:0005794 | Golgi apparatus | CC |
GO:0007569 | cell aging | BP |
GO:0008147 | structural constituent of bone | MF |
GO:0042995 | cell projection | CC |
GO:0033594 | response to hydroxyisoflavone | BP |
GO:0045471 | response to ethanol | BP |
GO:0010043 | response to zinc ion | BP |
GO:0033574 | response to testosterone stimulus | BP |
>gi|11761543|ref|NP_038200.1| osteocalcin preproprotein [Rattus norvegicus] MRTLSLLTLLALTAFCLSDLAGAKPSDSESDKAFMSKQEGSKVVNRLRRYLNNGLGAPAPYPDPLEPHRE VCELNPNCDELADHIGFQDAYKRIYGTTV |
Ensembl Gene |
ENSRNOT00000026530 |
---|---|
UniGene |
Rn.9722 |
PDB | |
RefSeq |
NP_038200.1 |
Pfam |
PF00594 |