Text mining Term | caveolin 1 |
---|---|
UniProt ID | CAV1_MOUSE |
Name |
Caveolin-1 |
Gene Names |
Cav1
Synonyms:Cav |
Taxonomy | Mus musculus |
Function |
Involved in the costimulatory signal essential for T- cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar membranes. Interacts directly with G- protein alpha subunits and can functionally regulate their activity. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. |
---|---|
Subcellular location |
Golgi apparatus membrane; Peripheral membrane protein (By similarity). Cell membrane; Peripheral membrane protein (By similarity). Membrane, caveola; Peripheral membrane protein (By similarity). Membrane raft (By similarity). Note=Colocalized with DPP4 in membrane rafts. Potential hairpin- like structure in the membrane. Membrane protein of caveolae (By similarity). |
GO:0006816 | calcium ion transport | BP |
GO:0000139 | Golgi membrane | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0010524 | positive regulation of calcium ion transport into cytosol | BP |
GO:0042632 | cholesterol homeostasis | BP |
GO:0019861 | flagellum | CC |
GO:0030857 | negative regulation of epithelial cell differentiation | BP |
GO:0001937 | negative regulation of endothelial cell proliferation | BP |
GO:0051260 | protein homooligomerization | BP |
GO:0090090 | negative regulation of canonical Wnt receptor signaling pathway | BP |
GO:0000299 | integral to membrane of membrane fraction | CC |
GO:0042310 | vasoconstriction | BP |
GO:0000188 | inactivation of MAPK activity | BP |
GO:0042524 | negative regulation of tyrosine phosphorylation of Stat5 protein | BP |
GO:0031295 | T cell costimulation | BP |
GO:0005887 | integral to plasma membrane | CC |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0051592 | response to calcium ion | BP |
GO:0043234 | protein complex | CC |
GO:0019217 | regulation of fatty acid metabolic process | BP |
GO:0045019 | negative regulation of nitric oxide biosynthetic process | BP |
GO:0001570 | vasculogenesis | BP |
GO:0001960 | negative regulation of cytokine-mediated signaling pathway | BP |
GO:0016504 | peptidase activator activity | MF |
GO:0007519 | skeletal muscle tissue development | BP |
GO:0060056 | mammary gland involution | BP |
GO:0007595 | lactation | BP |
GO:0006641 | triglyceride metabolic process | BP |
GO:0019915 | lipid storage | BP |
GO:0002080 | acrosomal membrane | CC |
GO:0045907 | positive regulation of vasoconstriction | BP |
GO:0001666 | response to hypoxia | BP |
GO:0006940 | regulation of smooth muscle contraction | BP |
GO:0005938 | cell cortex | CC |
GO:0048471 | perinuclear region of cytoplasm | CC |
GO:0005768 | endosome | CC |
GO:0033484 | nitric oxide homeostasis | BP |
GO:0048554 | positive regulation of metalloenzyme activity | BP |
GO:0051899 | membrane depolarization | BP |
GO:0005901 | caveola | CC |
GO:0000165 | MAPKKK cascade | BP |
>gi|340139110|ref|NP_001229993.1| caveolin-1 isoform 2 [Mus musculus] MADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYR LLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIR ISTQKEI |
Ensembl Gene |
ENSMUST00000115454 ENSMUST00000115456 ENSMUST00000115453 ENSMUST00000007799 |
---|---|
UniGene |
Mm.470537 Mm.28278 |
PDB | |
RefSeq |
NP_031642.1 NP_001229993.1 |
Pfam |
PF01146 |