Text mining Term | p22phox |
---|---|
UniProt ID | CY24A_RAT |
Name |
p22-phox Neutrophil cytochrome b 22 kDa polypeptide Cytochrome b558 subunit alpha Cytochrome b(558) alpha chain p22 phagocyte B-cytochrome p22phox Superoxide-generating NADPH oxidase light chain subunit Cytochrome b-245 light chain |
Gene Names |
Cyba
|
Taxonomy | Rattus norvegicus |
Function |
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide. |
---|---|
Subcellular location |
Membrane (Potential). |
GO:0022900 | electron transport chain | BP |
GO:0042493 | response to drug | BP |
GO:0005794 | Golgi apparatus | CC |
GO:0001938 | positive regulation of endothelial cell proliferation | BP |
GO:0071407 | cellular response to organic cyclic compound | BP |
GO:0031667 | response to nutrient levels | BP |
GO:0070555 | response to interleukin-1 | BP |
GO:0016324 | apical plasma membrane | CC |
GO:0043020 | NADPH oxidase complex | CC |
GO:0071260 | cellular response to mechanical stimulus | BP |
GO:0071230 | cellular response to amino acid stimulus | BP |
GO:0043025 | neuronal cell body | CC |
GO:0030307 | positive regulation of cell growth | BP |
GO:0014895 | smooth muscle hypertrophy | BP |
GO:0030425 | dendrite | CC |
GO:0071480 | cellular response to gamma radiation | BP |
GO:0003106 | negative regulation of glomerular filtration by angiotensin | BP |
GO:0050665 | hydrogen peroxide biosynthetic process | BP |
GO:0071333 | cellular response to glucose stimulus | BP |
GO:0006810 | transport | BP |
GO:0071356 | cellular response to tumor necrosis factor | BP |
GO:0020037 | heme binding | MF |
GO:0042554 | superoxide anion generation | BP |
>gi|13162359|ref|NP_077074.1| cytochrome b-245 light chain [Rattus norvegicus] MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQ KYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKE RPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV |
Ensembl Gene | |
---|---|
UniGene |
Rn.5856 |
PDB | |
RefSeq |
NP_077074.1 |
Pfam |
PF05038 |