Text mining Term | interleukin 6 |
---|---|
UniProt ID | IL6_RAT |
Name |
IL-6 Interleukin-6 |
Gene Names |
Il6
|
Taxonomy | Rattus norvegicus |
Function |
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0070374 | positive regulation of ERK1 and ERK2 cascade | BP |
GO:0045454 | cell redox homeostasis | BP |
GO:0005138 | interleukin-6 receptor binding | MF |
GO:0005125 | cytokine activity | MF |
GO:0051602 | response to electrical stimulus | BP |
GO:0005615 | extracellular space | CC |
GO:0031667 | response to nutrient levels | BP |
GO:0008083 | growth factor activity | MF |
GO:0051592 | response to calcium ion | BP |
GO:0008285 | negative regulation of cell proliferation | BP |
GO:0051897 | positive regulation of protein kinase B signaling cascade | BP |
GO:0009612 | response to mechanical stimulus | BP |
GO:0046849 | bone remodeling | BP |
GO:0007568 | aging | BP |
GO:0051971 | positive regulation of transmission of nerve impulse | BP |
GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | BP |
GO:0046677 | response to antibiotic | BP |
GO:0033160 | positive regulation of protein import into nucleus, translocation | BP |
GO:0009408 | response to heat | BP |
GO:0008360 | regulation of cell shape | BP |
GO:0045666 | positive regulation of neuron differentiation | BP |
GO:0045188 | regulation of circadian sleep/wake cycle, non-REM sleep | BP |
GO:0048635 | negative regulation of muscle organ development | BP |
GO:0006469 | negative regulation of protein kinase activity | BP |
GO:0006953 | acute-phase response | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0043526 | neuroprotection | BP |
GO:0009409 | response to cold | BP |
GO:0045721 | negative regulation of gluconeogenesis | BP |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | BP |
GO:0042517 | positive regulation of tyrosine phosphorylation of Stat3 protein | BP |
GO:0045740 | positive regulation of DNA replication | BP |
GO:0050710 | negative regulation of cytokine secretion | BP |
GO:0032868 | response to insulin stimulus | BP |
GO:0031000 | response to caffeine | BP |
GO:0016049 | cell growth | BP |
GO:0042493 | response to drug | BP |
GO:0043200 | response to amino acid stimulus | BP |
>gi|7549769|ref|NP_036721.1| interleukin-6 precursor [Rattus norvegicus] MKFLSARDFQPVAFLGLMLLTATAFPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELC NGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKAR VIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEWLRTKTIQLILKALEEFLKVTMRSTRQ T |
Ensembl Gene | |
---|---|
UniGene |
Rn.9873 |
PDB | |
RefSeq |
NP_036721.1 |
Pfam |
PF00489 |