Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0014076 | response to fluoxetine | BP |
GO:0072347 | response to anesthetic | BP |
GO:0005576 | extracellular region | CC |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0008083 | growth factor activity | MF |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0042493 | response to drug | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0030182 | neuron differentiation | BP |
GO:0050890 | cognition | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0033189 | response to vitamin A | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |