Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0042493 | response to drug | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0072347 | response to anesthetic | BP |
GO:0008083 | growth factor activity | MF |
GO:0005576 | extracellular region | CC |
GO:0050890 | cognition | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0030182 | neuron differentiation | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0033189 | response to vitamin A | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |