Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0009725 | response to hormone stimulus | BP |
GO:0030182 | neuron differentiation | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0008083 | growth factor activity | MF |
GO:0042493 | response to drug | BP |
GO:0072347 | response to anesthetic | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0050890 | cognition | BP |
GO:0033189 | response to vitamin A | BP |
GO:0005576 | extracellular region | CC |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0001666 | response to hypoxia | BP |
GO:0002544 | chronic inflammatory response | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |