Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0050890 | cognition | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0042493 | response to drug | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0014076 | response to fluoxetine | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0001666 | response to hypoxia | BP |
GO:0072347 | response to anesthetic | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0005576 | extracellular region | CC |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0033189 | response to vitamin A | BP |
GO:0008083 | growth factor activity | MF |
GO:0002544 | chronic inflammatory response | BP |
GO:0030182 | neuron differentiation | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |