Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0009725 | response to hormone stimulus | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0050890 | cognition | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0072347 | response to anesthetic | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0005576 | extracellular region | CC |
GO:0042493 | response to drug | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0008083 | growth factor activity | MF |
GO:0001666 | response to hypoxia | BP |
GO:0030182 | neuron differentiation | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0033189 | response to vitamin A | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |