Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0072347 | response to anesthetic | BP |
GO:0050890 | cognition | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0008083 | growth factor activity | MF |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0005576 | extracellular region | CC |
GO:0042493 | response to drug | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0033189 | response to vitamin A | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0030182 | neuron differentiation | BP |
GO:0002544 | chronic inflammatory response | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |