Text mining Term | P23 |
---|---|
UniProt ID | CD5R1_RAT |
Name |
Cyclin-dependent kinase 5 activator 1, p25 TPKII regulatory subunit p25 CDK5 activator 1 p23 Cyclin-dependent kinase 5 activator 1, p35 Cyclin-dependent kinase 5 regulatory subunit 1 Cyclin-dependent kinase 5 activator 1 Tau protein kinase II 23 kDa subunit p35 |
Gene Names |
Cdk5r1
Synonyms:Cdk5r |
Taxonomy | Rattus norvegicus |
Function |
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. |
---|---|
Subcellular location |
Cyclin-dependent kinase 5 activator 1, p35: Cell membrane; Lipid-anchor; Cytoplasmic side (By similarity).
Cyclin-dependent kinase 5 activator 1, p25: Nucleus (By similarity). Cytoplasm, perinuclear region (By similarity). Note=The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions (By similarity). |
GO:0030426 | growth cone | CC |
GO:0043025 | neuronal cell body | CC |
GO:0005886 | plasma membrane | CC |
GO:0016533 | cyclin-dependent protein kinase 5 holoenzyme complex | CC |
GO:0048471 | perinuclear region of cytoplasm | CC |
GO:0048675 | axon extension | BP |
GO:0043525 | positive regulation of neuron apoptosis | BP |
GO:0045296 | cadherin binding | MF |
GO:0007158 | neuron cell-cell adhesion | BP |
GO:0016534 | cyclin-dependent protein kinase 5 activator activity | MF |
GO:0046875 | ephrin receptor binding | MF |
GO:0048013 | ephrin receptor signaling pathway | BP |
GO:0005509 | calcium ion binding | MF |
GO:0061001 | regulation of dendritic spine morphogenesis | BP |
GO:0043292 | contractile fiber | CC |
GO:0007411 | axon guidance | BP |
GO:0001764 | neuron migration | BP |
GO:0030424 | axon | CC |
GO:0014069 | postsynaptic density | CC |
GO:0031594 | neuromuscular junction | CC |
GO:0007213 | G-protein coupled acetylcholine receptor signaling pathway | BP |
GO:0007413 | axonal fasciculation | BP |
GO:0035235 | ionotropic glutamate receptor signaling pathway | BP |
GO:0009790 | embryo development | BP |
GO:0004693 | cyclin-dependent protein kinase activity | MF |
>gi|16758762|ref|NP_446343.1| cyclin-dependent kinase 5 activator 1 [Rattus norvegicus] MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQP NSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPK RVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRD VISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPH YFTQVFSDLKNESGQEDKKRLLLGLDR |
Ensembl Gene |
ENSRNOT00000031746 |
---|---|
UniGene |
Rn.11213 |
PDB | |
RefSeq |
NP_446343.1 |
Pfam |
PF03261 |