Text mining Term | endothelin 1 |
---|---|
UniProt ID | EDN1_RAT |
Name |
Endothelin-1 ET-1 Preproendothelin-1 PPET1 |
Gene Names |
Edn1
|
Taxonomy | Rattus norvegicus |
Function |
Endothelins are endothelium-derived vasoconstrictor peptides. |
---|---|
Subcellular location |
Secreted. |
GO:0046888 | negative regulation of hormone secretion | BP |
GO:0001821 | histamine secretion | BP |
GO:0051930 | regulation of sensory perception of pain | BP |
GO:0060137 | maternal process involved in parturition | BP |
GO:0031707 | endothelin A receptor binding | MF |
GO:0045987 | positive regulation of smooth muscle contraction | BP |
GO:0042554 | superoxide anion generation | BP |
GO:0042482 | positive regulation of odontogenesis | BP |
GO:0033574 | response to testosterone stimulus | BP |
GO:0042045 | epithelial fluid transport | BP |
GO:0016049 | cell growth | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0019229 | regulation of vasoconstriction | BP |
GO:0019233 | sensory perception of pain | BP |
GO:0071347 | cellular response to interleukin-1 | BP |
GO:0043200 | response to amino acid stimulus | BP |
GO:0042493 | response to drug | BP |
GO:0071356 | cellular response to tumor necrosis factor | BP |
GO:0031708 | endothelin B receptor binding | MF |
GO:0051899 | membrane depolarization | BP |
GO:0010259 | multicellular organismal aging | BP |
GO:0034392 | negative regulation of smooth muscle cell apoptosis | BP |
GO:0007243 | intracellular protein kinase cascade | BP |
GO:0035094 | response to nicotine | BP |
GO:0090023 | positive regulation of neutrophil chemotaxis | BP |
GO:0005615 | extracellular space | CC |
GO:0001666 | response to hypoxia | BP |
>gi|6978791|ref|NP_036680.1| endothelin-1 preproprotein [Rattus norvegicus] MDYFPVIFSLLFVAFQGAPETAVLGAELSPRAEKEVQSPPPSTSWRPRRSKRCSCSSLMDKECVYFCHLD IIWVNTPERVVPYGLGSPSRSKRSLKDLLPTKTTDQGNRCQCAHQKDKKCWNFCQADKELRAQSTMQKGV KDFKKGKPCPKLGKKCIYQQLVEGRKLRRLEAISNSIKTSFRVAKLKAELYRDQKLIHNRAH |
Ensembl Gene |
ENSRNOT00000019361 |
---|---|
UniGene |
Rn.10918 |
PDB |
3CMH 6CMH |
RefSeq |
NP_036680.1 |
Pfam |
PF00322 |