Text mining Term | cholecystokinin |
---|---|
UniProt ID | CCKN_RAT |
Name |
Cholecystokinin CCK33 CCK12 CCK39 CCK22 CCK8 Cholecystokinin-12 CCK Cholecystokinin-8 Cholecystokinin-22 Cholecystokinin-39 Cholecystokinin-33 |
Gene Names |
Cck
|
Taxonomy | Rattus norvegicus |
Function |
This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
---|---|
Subcellular location |
Secreted. |
GO:0001764 | neuron migration | BP |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0007409 | axonogenesis | BP |
GO:0032461 | positive regulation of protein oligomerization | BP |
GO:0005615 | extracellular space | CC |
GO:0030425 | dendrite | CC |
GO:0001662 | behavioral fear response | BP |
GO:0051930 | regulation of sensory perception of pain | BP |
GO:0005184 | neuropeptide hormone activity | MF |
GO:0043065 | positive regulation of apoptotic process | BP |
GO:0043194 | initial segment | CC |
GO:0051901 | positive regulation of mitochondrial depolarization | BP |
GO:0043195 | terminal button | CC |
GO:0043204 | perikaryon | CC |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | BP |
GO:0006919 | activation of caspase activity | BP |
GO:0007205 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | BP |
GO:0043203 | axon hillock | CC |
GO:0032099 | negative regulation of appetite | BP |
GO:0001836 | release of cytochrome c from mitochondria | BP |
GO:0042755 | eating behavior | BP |
>gi|6978613|ref|NP_036961.1| cholecystokinin preproprotein [Rattus norvegicus] MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARYIQQVR KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS |
Ensembl Gene |
ENSRNOT00000026159 |
---|---|
UniGene |
Rn.9781 |
PDB | |
RefSeq |
NP_036961.1 |
Pfam |
PF00918 |