| Text mining Term | tumor suppressor p53 |
|---|---|
| UniProt ID | P53_RAT |
| Name |
Tumor suppressor p53 Cellular tumor antigen p53 |
| Gene Names |
Tp53
Synonyms:P53 |
| Taxonomy | Rattus norvegicus |
| Function |
Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity). |
|---|---|
| Subcellular location |
Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Note=Interaction with BANP promotes nuclear localization (By similarity). |
| GO:0007569 | cell aging | BP |
| GO:0003684 | damaged DNA binding | MF |
| GO:0071417 | cellular response to organic nitrogen | BP |
| GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
| GO:0005783 | endoplasmic reticulum | CC |
| GO:0005739 | mitochondrion | CC |
| GO:0005667 | transcription factor complex | CC |
| GO:0006351 | transcription, DNA-dependent | BP |
| GO:0007049 | cell cycle | BP |
| GO:0034097 | response to cytokine stimulus | BP |
| GO:0055093 | response to hyperoxia | BP |
| GO:0003682 | chromatin binding | MF |
| GO:0005507 | copper ion binding | MF |
| GO:0043565 | sequence-specific DNA binding | MF |
| GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | BP |
| GO:0005524 | ATP binding | MF |
| GO:0010038 | response to metal ion | BP |
| GO:0006979 | response to oxidative stress | BP |
| GO:0008022 | protein C-terminus binding | MF |
| GO:0003700 | sequence-specific DNA binding transcription factor activity | MF |
| GO:0005625 | soluble fraction | CC |
| GO:0031065 | positive regulation of histone deacetylation | BP |
| GO:0043200 | response to amino acid stimulus | BP |
| GO:0034644 | cellular response to UV | BP |
| GO:0045787 | positive regulation of cell cycle | BP |
| GO:0032526 | response to retinoic acid | BP |
| GO:0031625 | ubiquitin protein ligase binding | MF |
| GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | BP |
| GO:0030308 | negative regulation of cell growth | BP |
| GO:0033552 | response to vitamin B3 | BP |
| GO:0044212 | transcription regulatory region DNA binding | MF |
| GO:0031571 | mitotic cell cycle G1/S transition DNA damage checkpoint | BP |
| GO:0005730 | nucleolus | CC |
| GO:0051453 | regulation of intracellular pH | BP |
| GO:0000739 | DNA strand annealing activity | MF |
| GO:0006289 | nucleotide-excision repair | BP |
| GO:0042493 | response to drug | BP |
| GO:0010332 | response to gamma radiation | BP |
| GO:0010165 | response to X-ray | BP |
| GO:0002039 | p53 binding | MF |
| GO:0051262 | protein tetramerization | BP |
| GO:2000279 | negative regulation of DNA biosynthetic process | BP |
| GO:0042060 | wound healing | BP |
| GO:0043525 | positive regulation of neuron apoptosis | BP |
| GO:0031000 | response to caffeine | BP |
| GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | BP |
| GO:0007275 | multicellular organismal development | BP |
| GO:0008635 | activation of caspase activity by cytochrome c | BP |
| GO:0000785 | chromatin | CC |
| GO:0005829 | cytosol | CC |
| GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
| GO:0005657 | replication fork | CC |
| GO:0002687 | positive regulation of leukocyte migration | BP |
>gi|189083686|ref|NP_112251.2| cellular tumor antigen p53 [Rattus norvegicus] MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAA QEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCP VQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTF RHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDR RTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKD ARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD |
| Ensembl Gene |
ENSRNOT00000046490 |
|---|---|
| UniGene |
Rn.54443 |
| PDB | |
| RefSeq |
NP_112251.2 |
| Pfam |
PF08563 PF00870 PF07710 |