tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

Text mining Term tumor suppressor p53
UniProt ID P53_MOUSE
Name Cellular tumor antigen p53
Tumor suppressor p53
Gene Names Tp53
Taxonomy Mus musculus

General annotation

Function Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).
Subcellular location Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Nucleus, PML body (By similarity). Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2 (By similarity).

Gene Ontology

GO:0009303 rRNA transcription BP
GO:0010332 response to gamma radiation BP
GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis BP
GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest BP
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation BP
GO:0035264 multicellular organism growth BP
GO:0034644 cellular response to UV BP
GO:0044212 transcription regulatory region DNA binding MF
GO:0010165 response to X-ray BP
GO:0001701 in utero embryonic development BP
GO:0005667 transcription factor complex CC
GO:0003682 chromatin binding MF
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway BP
GO:0007417 central nervous system development BP
GO:0000785 chromatin CC
GO:0007049 cell cycle BP
GO:0051262 protein tetramerization BP
GO:0070215 MDM2 binding MF
GO:0046902 regulation of mitochondrial membrane permeability BP
GO:0007569 cell aging BP
GO:0008340 determination of adult lifespan BP
GO:0000739 DNA strand annealing activity MF
GO:0003684 damaged DNA binding MF
GO:0002039 p53 binding MF
GO:0031065 positive regulation of histone deacetylation BP
GO:0002326 B cell lineage commitment BP
GO:0005524 ATP binding MF
GO:0043525 positive regulation of neuron apoptosis BP
GO:0006302 double-strand break repair BP
GO:0008156 negative regulation of DNA replication BP
GO:0016605 PML body CC
GO:0033077 T cell differentiation in thymus BP
GO:0005507 copper ion binding MF
GO:0007369 gastrulation BP
GO:0000060 protein import into nucleus, translocation BP
GO:0002309 T cell proliferation involved in immune response BP
GO:0048147 negative regulation of fibroblast proliferation BP
GO:0035033 histone deacetylase regulator activity MF
GO:0042493 response to drug BP
GO:0051276 chromosome organization BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0001756 somitogenesis BP
GO:0043565 sequence-specific DNA binding MF
GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator BP
GO:0043066 negative regulation of apoptotic process BP
GO:0001836 release of cytochrome c from mitochondria BP
GO:0005730 nucleolus CC
GO:0001077 RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription MF
GO:0030308 negative regulation of cell growth BP
GO:0005657 replication fork CC
GO:0007406 negative regulation of neuroblast proliferation BP
GO:0002360 T cell lineage commitment BP
GO:0005783 endoplasmic reticulum CC
GO:0005829 cytosol CC
GO:0005739 mitochondrion CC
GO:0070245 positive regulation of thymocyte apoptosis BP
GO:0008635 activation of caspase activity by cytochrome c BP
GO:0090343 positive regulation of cell aging BP
GO:0006289 nucleotide-excision repair BP

Sequence

>gi|187960040|ref|NP_001120705.1| cellular tumor antigen p53 isoform b [Mus musculus]
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQ
DPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPV
QLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFR
HSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRR
TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDA
HATEESGDSRAHSSLQPRAFQALIKEESPNC

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000005371
UniGene Mm.222
PDB 2IOI
3EXJ
2IOM
3EXL
2IOO
2GEQ
1HU8
2P52
RefSeq NP_035770.2
NP_001120705.1
Pfam PF07710
PF00870
PF08563