tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

Text mining Term tumor suppressor p53
UniProt ID P53_RAT
Name Tumor suppressor p53
Cellular tumor antigen p53
Gene Names Tp53
Synonyms:P53
Taxonomy Rattus norvegicus

General annotation

Function Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).
Subcellular location Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Note=Interaction with BANP promotes nuclear localization (By similarity).

Gene Ontology

GO:0007275 multicellular organismal development BP
GO:0010165 response to X-ray BP
GO:0031065 positive regulation of histone deacetylation BP
GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis BP
GO:0051453 regulation of intracellular pH BP
GO:0043565 sequence-specific DNA binding MF
GO:0003682 chromatin binding MF
GO:0005625 soluble fraction CC
GO:0033552 response to vitamin B3 BP
GO:0043525 positive regulation of neuron apoptosis BP
GO:0006351 transcription, DNA-dependent BP
GO:2000279 negative regulation of DNA biosynthetic process BP
GO:0000785 chromatin CC
GO:0006289 nucleotide-excision repair BP
GO:0007049 cell cycle BP
GO:0005783 endoplasmic reticulum CC
GO:0008022 protein C-terminus binding MF
GO:0032526 response to retinoic acid BP
GO:0071417 cellular response to organic nitrogen BP
GO:0005507 copper ion binding MF
GO:0043200 response to amino acid stimulus BP
GO:0008635 activation of caspase activity by cytochrome c BP
GO:0005524 ATP binding MF
GO:0006979 response to oxidative stress BP
GO:0042060 wound healing BP
GO:0031625 ubiquitin protein ligase binding MF
GO:0002039 p53 binding MF
GO:0044212 transcription regulatory region DNA binding MF
GO:0034644 cellular response to UV BP
GO:0055093 response to hyperoxia BP
GO:0051262 protein tetramerization BP
GO:0045787 positive regulation of cell cycle BP
GO:0034097 response to cytokine stimulus BP
GO:0003684 damaged DNA binding MF
GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0003700 sequence-specific DNA binding transcription factor activity MF
GO:0048662 negative regulation of smooth muscle cell proliferation BP
GO:0010038 response to metal ion BP
GO:0031571 mitotic cell cycle G1/S transition DNA damage checkpoint BP
GO:0005730 nucleolus CC
GO:0005829 cytosol CC
GO:0042493 response to drug BP
GO:0005739 mitochondrion CC
GO:0045944 positive regulation of transcription from RNA polymerase II promoter BP
GO:0031000 response to caffeine BP
GO:0005657 replication fork CC
GO:0030308 negative regulation of cell growth BP
GO:0005667 transcription factor complex CC
GO:0010332 response to gamma radiation BP
GO:0002687 positive regulation of leukocyte migration BP
GO:0000739 DNA strand annealing activity MF
GO:0007569 cell aging BP

Sequence

>gi|189083686|ref|NP_112251.2| cellular tumor antigen p53 [Rattus norvegicus]
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAA
QEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCP
VQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTF
RHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDR
RTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKD
ARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000046490
UniGene Rn.54443
PDB
RefSeq NP_112251.2
Pfam PF08563
PF07710
PF00870