| Text mining Term | androgen receptor |
|---|---|
| UniProt ID | ANDR_MOUSE |
| Name |
Androgen receptor Nuclear receptor subfamily 3 group C member 4 Dihydrotestosterone receptor |
| Gene Names |
Ar
Synonyms:Nr3c4 |
| Taxonomy | Mus musculus |
| Function |
Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3 (By similarity). |
|---|---|
| Subcellular location |
Nucleus. Cytoplasm (By similarity). Note=Predominantly cytoplasmic in unliganded form but translocates to the nucleus upon ligand-binding. Can also translocate to the nucleus in unliganded form in the presence of GNB2L1 (By similarity). |
| GO:0006351 | transcription, DNA-dependent | BP |
| GO:0048808 | male genitalia morphogenesis | BP |
| GO:0008284 | positive regulation of cell proliferation | BP |
| GO:0060748 | tertiary branching involved in mammary gland duct morphogenesis | BP |
| GO:0019899 | enzyme binding | MF |
| GO:0003706 | ligand-regulated transcription factor activity | MF |
| GO:0001701 | in utero embryonic development | BP |
| GO:0060599 | lateral sprouting involved in mammary gland duct morphogenesis | BP |
| GO:0043568 | positive regulation of insulin-like growth factor receptor signaling pathway | BP |
| GO:0003700 | sequence-specific DNA binding transcription factor activity | MF |
| GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
| GO:0004882 | androgen receptor activity | MF |
| GO:0043565 | sequence-specific DNA binding | MF |
| GO:0043066 | negative regulation of apoptotic process | BP |
| GO:0050790 | regulation of catalytic activity | BP |
| GO:0019102 | male somatic sex determination | BP |
| GO:0060685 | regulation of prostatic bud formation | BP |
| GO:0050680 | negative regulation of epithelial cell proliferation | BP |
| GO:0060749 | mammary gland alveolus development | BP |
| GO:0060571 | morphogenesis of an epithelial fold | BP |
| GO:0044212 | transcription regulatory region DNA binding | MF |
| GO:0090003 | regulation of establishment of protein localization in plasma membrane | BP |
| GO:0060740 | prostate gland epithelium morphogenesis | BP |
| GO:0005737 | cytoplasm | CC |
| GO:0048645 | organ formation | BP |
| GO:0008270 | zinc ion binding | MF |
| GO:0051092 | positive regulation of NF-kappaB transcription factor activity | BP |
| GO:0034339 | regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor | BP |
| GO:0048638 | regulation of developmental growth | BP |
| GO:0060520 | activation of prostate induction by androgen receptor signaling pathway | BP |
| GO:0042327 | positive regulation of phosphorylation | BP |
| GO:0008584 | male gonad development | BP |
| GO:0060742 | epithelial cell differentiation involved in prostate gland development | BP |
| GO:0070974 | POU domain binding | MF |
| GO:0045720 | negative regulation of integrin biosynthetic process | BP |
| GO:0008013 | beta-catenin binding | MF |
| GO:0043410 | positive regulation of MAPKKK cascade | BP |
| GO:0033148 | positive regulation of estrogen receptor signaling pathway | BP |
| GO:0060736 | prostate gland growth | BP |
| GO:0000790 | nuclear chromatin | CC |
>gi|7304901|ref|NP_038504.1| androgen receptor [Mus musculus] MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQETSPRRRRRQQH TEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAPGKGLPQQPPAPPDQDDSAAP STLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQQHQQQHQQHQQQQEVISEGSSARAREATGA PSSSKDSYLGGNSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPL PECKGLPLDEGPGKSTEETAEYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGALDEAA AYQNRDYYNFPLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGSVAGPSTGSP PATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVAPYGYTRPPQGLTSQESDYSASEVWYPGGVVNR VPYPSPNCVKSEMGPWMENYSGPYGDMRLDSTRDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCK VFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGENSNAGS PTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAK ALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHL SQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLT KLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ |
| Ensembl Gene |
ENSMUST00000052837 |
|---|---|
| UniGene |
Mm.394224 Mm.439657 Mm.39005 |
| PDB |
2QPY |
| RefSeq |
NP_038504.1 |
| Pfam |
PF02166 PF00105 PF00104 |