IL 10

General Information (Source: NCBI Gene,UniProt)

Text mining Term IL 10
UniProt ID IL10_RAT
Name Cytokine synthesis inhibitory factor
CSIF
Interleukin-10
IL-10
Gene Names Il10
Taxonomy Rattus norvegicus

General annotation

Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells (By similarity).
Subcellular location Secreted.

Gene Ontology

GO:0002904 positive regulation of B cell apoptosis BP
GO:0050715 positive regulation of cytokine secretion BP
GO:0042536 negative regulation of tumor necrosis factor biosynthetic process BP
GO:0051930 regulation of sensory perception of pain BP
GO:0051384 response to glucocorticoid stimulus BP
GO:0005615 extracellular space CC
GO:0005141 interleukin-10 receptor binding MF
GO:0045019 negative regulation of nitric oxide biosynthetic process BP
GO:0032800 receptor biosynthetic process BP
GO:0030889 negative regulation of B cell proliferation BP
GO:0032715 negative regulation of interleukin-6 production BP
GO:0045893 positive regulation of transcription, DNA-dependent BP
GO:0014854 response to inactivity BP
GO:0006955 immune response BP
GO:0051091 positive regulation of sequence-specific DNA binding transcription factor activity BP
GO:0032496 response to lipopolysaccharide BP
GO:0051045 negative regulation of membrane protein ectodomain proteolysis BP
GO:0071392 cellular response to estradiol stimulus BP
GO:0050728 negative regulation of inflammatory response BP
GO:0005125 cytokine activity MF
GO:0006954 inflammatory response BP
GO:0014823 response to activity BP
GO:0034465 response to carbon monoxide BP
GO:0032868 response to insulin stimulus BP
GO:0043066 negative regulation of apoptotic process BP
GO:0042493 response to drug BP
GO:0002740 negative regulation of cytokine secretion involved in immune response BP

Sequence

>gi|148747382|ref|NP_036986.2| interleukin-10 precursor [Rattus norvegicus]
MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSL
LQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVE
QVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000006246
UniGene Rn.9868
PDB
RefSeq NP_036986.2
Pfam PF00726