| Text mining Term | albumin |
|---|---|
| UniProt ID | 2SS_TAROF |
| Name |
2S albumin 2S albumin large chain To-A1 2S albumin small chain |
| Gene Names |
|
| Taxonomy | Taraxacum officinale |
| Function |
This is a 2S seed storage protein. Has antifungal activity. Inhibits spore germination in H.sativum (IC(50)=62.5 ug/ml) and P.betae (IC(50)=62.5 ug/ml). Inhibits growth of H.sativum, V.albo-atrum and P.infestans. |
|---|---|
| Subcellular location |
| GO:0050832 | defense response to fungus | BP |
| GO:0031640 | killing of cells of other organism | BP |
| GO:0045735 | nutrient reservoir activity | MF |
| GO:0002229 | defense response to oomycetes | BP |
>gi|308189456|sp|P86783.1|2SS_TAROF RecName: Full=2S albumin; AltName: Full=To-A1; Contains: RecName: Full=2S albumin small chain; Contains: RecName: Full=2S albumin large chain PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |