| Text mining Term | cytochrome c |
|---|---|
| UniProt ID | CYC_ABUTH |
| Name |
Cytochrome c |
| Gene Names |
|
| Taxonomy | Abutilon theophrasti |
| Function |
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. |
|---|---|
| Subcellular location |
Mitochondrion matrix. |
| GO:0006810 | transport | BP |
| GO:0009055 | electron carrier activity | MF |
| GO:0020037 | heme binding | MF |
| GO:0005759 | mitochondrial matrix | CC |
| GO:0022900 | electron transport chain | BP |
| GO:0070469 | respiratory chain | CC |
>gi|117952|sp|P00059.1|CYC_ABUTH RecName: Full=Cytochrome c ASFQZAPPGBAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWGEN TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF00034 |