| Text mining Term | CF 1 (protein family or complex) |
|---|---|
| UniProt ID | ATPB_SCHGA |
| Name |
ATP synthase subunit beta, mitochondrial |
| Gene Names |
|
| Taxonomy | Schizaphis graminum |
| Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. |
|---|---|
| Subcellular location |
Mitochondrion. Mitochondrion inner membrane. Note=Peripheral membrane protein. |
| GO:0015986 | ATP synthesis coupled proton transport | BP |
| GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1) | CC |
| GO:0046933 | hydrogen ion transporting ATP synthase activity, rotational mechanism | MF |
| GO:0005524 | ATP binding | MF |
| GO:0008553 | hydrogen-exporting ATPase activity, phosphorylative mechanism | MF |
| GO:0005743 | mitochondrial inner membrane | CC |
>gi|1168581|sp|Q07233.1|ATPB_SCHGA RecName: Full=ATP synthase subunit beta, mitochondrial VLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIESGVISLKDKTSKVALVYGQMNEPPGARARVA LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTSKGS ITSVQAIYVPADDLTDPA |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF00006 |