| Text mining Term | IgE |
|---|---|
| UniProt ID | MYR1_MYRPI |
| Name |
Pilosulin-1 Pilosulin-1 Pilosulin-1 65->112 Major allergen Myr p 1 Pilosulin-1 86->112 Allergen Myr p I Pilosulin-1 71->112 Pilosulin-1 68->112 |
| Gene Names |
|
| Taxonomy | Myrmecia pilosula |
| Function |
Has strong cytotoxic and hemolytic activities. Is more potent against mononuclear leukocytes than against granulocytes. The synthesized peptide 57-76 shows a potent and broad spectrum antimicrobial activity against both Gram-positive and Gram- negative bacteria, and also against the fungus C.albicans. Adopts an alpha-helical structure. |
|---|---|
| Subcellular location |
Secreted. |
| GO:0044179 | hemolysis in other organism | BP |
| GO:0005576 | extracellular region | CC |
| GO:0019835 | cytolysis | BP |
| GO:0050832 | defense response to fungus | BP |
| GO:0042742 | defense response to bacterium | BP |
>gi|730091|sp|Q07932.1|MYR1_MYRPI RecName: Full=Pilosulin-1; AltName: Full=Allergen Myr p I; AltName: Full=Major allergen Myr p 1; AltName: Allergen=Myr p 1; Contains: RecName: Full=Pilosulin-1; Contains: RecName: Full=Pilosulin-1 65->112; Contains: RecName: Full=Pilosulin-1 68->112; Contains: RecName: Full=Pilosulin-1 71->112; Contains: RecName: Full=Pilosulin-1 86->112; Flags: Precursor MKLSCLLLTLTIIFVLTIVHAPNVEAKDLADPESEAVGFADAFGEADAVGEADPNAGLGSVFGRLARILG RVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |