Text mining Term | IgE |
---|---|
UniProt ID | MYR1_MYRPI |
Name |
Pilosulin-1 Allergen Myr p I Pilosulin-1 68->112 Pilosulin-1 Pilosulin-1 65->112 Pilosulin-1 86->112 Major allergen Myr p 1 Pilosulin-1 71->112 |
Gene Names |
|
Taxonomy | Myrmecia pilosula |
Function |
Has strong cytotoxic and hemolytic activities. Is more potent against mononuclear leukocytes than against granulocytes. The synthesized peptide 57-76 shows a potent and broad spectrum antimicrobial activity against both Gram-positive and Gram- negative bacteria, and also against the fungus C.albicans. Adopts an alpha-helical structure. |
---|---|
Subcellular location |
Secreted. |
GO:0044179 | hemolysis in other organism | BP |
GO:0005576 | extracellular region | CC |
GO:0050832 | defense response to fungus | BP |
GO:0019835 | cytolysis | BP |
GO:0042742 | defense response to bacterium | BP |
>gi|730091|sp|Q07932.1|MYR1_MYRPI RecName: Full=Pilosulin-1; AltName: Full=Allergen Myr p I; AltName: Full=Major allergen Myr p 1; AltName: Allergen=Myr p 1; Contains: RecName: Full=Pilosulin-1; Contains: RecName: Full=Pilosulin-1 65->112; Contains: RecName: Full=Pilosulin-1 68->112; Contains: RecName: Full=Pilosulin-1 71->112; Contains: RecName: Full=Pilosulin-1 86->112; Flags: Precursor MKLSCLLLTLTIIFVLTIVHAPNVEAKDLADPESEAVGFADAFGEADAVGEADPNAGLGSVFGRLARILG RVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |