Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Osteonectin SPARC Basement-membrane protein 40 BM-40 Secreted protein acidic and rich in cysteine ON |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0007165 | signal transduction | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0001503 | ossification | BP |
GO:0042060 | wound healing | BP |
GO:0009629 | response to gravity | BP |
GO:0010288 | response to lead ion | BP |
GO:0048839 | inner ear development | BP |
GO:0030324 | lung development | BP |
GO:0007507 | heart development | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0005615 | extracellular space | CC |
GO:0051591 | response to cAMP | BP |
GO:0051592 | response to calcium ion | BP |
GO:0005634 | nucleus | CC |
GO:0005604 | basement membrane | CC |
GO:0005509 | calcium ion binding | MF |
GO:0034097 | response to cytokine stimulus | BP |
GO:0045471 | response to ethanol | BP |
GO:0005737 | cytoplasm | CC |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0033591 | response to L-ascorbic acid | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF09289 PF00050 PF10591 |