Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
ON SPARC Basement-membrane protein 40 Osteonectin Secreted protein acidic and rich in cysteine BM-40 |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0048839 | inner ear development | BP |
GO:0042060 | wound healing | BP |
GO:0009629 | response to gravity | BP |
GO:0007165 | signal transduction | BP |
GO:0001503 | ossification | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0005604 | basement membrane | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0007507 | heart development | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0005615 | extracellular space | CC |
GO:0051591 | response to cAMP | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0005634 | nucleus | CC |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0030324 | lung development | BP |
GO:0010288 | response to lead ion | BP |
GO:0045471 | response to ethanol | BP |
GO:0051592 | response to calcium ion | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0005737 | cytoplasm | CC |
GO:0005509 | calcium ion binding | MF |
GO:0033591 | response to L-ascorbic acid | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF09289 PF10591 PF00050 |