Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Secreted protein acidic and rich in cysteine BM-40 ON SPARC Osteonectin Basement-membrane protein 40 |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0005509 | calcium ion binding | MF |
GO:0009629 | response to gravity | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0007507 | heart development | BP |
GO:0007165 | signal transduction | BP |
GO:0051591 | response to cAMP | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0001503 | ossification | BP |
GO:0045471 | response to ethanol | BP |
GO:0051592 | response to calcium ion | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0042060 | wound healing | BP |
GO:0005604 | basement membrane | CC |
GO:0005737 | cytoplasm | CC |
GO:0005634 | nucleus | CC |
GO:0048839 | inner ear development | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0030324 | lung development | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0010288 | response to lead ion | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0005615 | extracellular space | CC |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF00050 PF09289 PF10591 |