kit ligand

General Information (Source: NCBI Gene,UniProt)

Text mining Term kit ligand
UniProt ID SCF_MOUSE
Name Steel factor
Kit ligand
SCF
Soluble KIT ligand
Hematopoietic growth factor KL
Stem cell factor
Mast cell growth factor
c-Kit ligand
sKITLG
MGF
Gene Names Kitlg
Taxonomy Mus musculus

General annotation

Function Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular location Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity). Soluble KIT ligand: Secreted (By similarity).

Gene Ontology

GO:0045636 positive regulation of melanocyte differentiation BP
GO:0005173 stem cell factor receptor binding MF
GO:0007281 germ cell development BP
GO:0035234 germ cell programmed cell death BP
GO:0033026 negative regulation of mast cell apoptosis BP
GO:0008083 growth factor activity MF
GO:0070668 positive regulation of mast cell proliferation BP
GO:0046579 positive regulation of Ras protein signal transduction BP
GO:0005737 cytoplasm CC
GO:0005615 extracellular space CC
GO:0007155 cell adhesion BP
GO:0016021 integral to membrane CC
GO:0005886 plasma membrane CC
GO:0001755 neural crest cell migration BP
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation BP
GO:0005125 cytokine activity MF
GO:0005856 cytoskeleton CC
GO:0002763 positive regulation of myeloid leukocyte differentiation BP

Sequence

>gi|7305267|ref|NP_038626.1| kit ligand precursor [Mus musculus]
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPED
SGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000020129
ENSMUST00000105283
UniGene Mm.45124
PDB 2O26
2O27
RefSeq NP_038626.1
Pfam PF02404