Text mining Term | kit ligand |
---|---|
UniProt ID | SCF_MOUSE |
Name |
Steel factor Stem cell factor MGF Kit ligand Soluble KIT ligand c-Kit ligand SCF Mast cell growth factor Hematopoietic growth factor KL sKITLG |
Gene Names |
Kitlg
|
Taxonomy | Mus musculus |
Function |
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
---|---|
Subcellular location |
Isoform 1: Cell membrane; Single-pass type I membrane protein (By similarity).
Isoform 2: Cell membrane; Single-pass type I membrane protein (By similarity). Cytoplasm, cytoskeleton (By similarity).
Soluble KIT ligand: Secreted (By similarity). |
GO:0035234 | germ cell programmed cell death | BP |
GO:0001755 | neural crest cell migration | BP |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | BP |
GO:0008083 | growth factor activity | MF |
GO:0005856 | cytoskeleton | CC |
GO:0007281 | germ cell development | BP |
GO:0005737 | cytoplasm | CC |
GO:0005173 | stem cell factor receptor binding | MF |
GO:0005886 | plasma membrane | CC |
GO:0007155 | cell adhesion | BP |
GO:0005615 | extracellular space | CC |
GO:0046579 | positive regulation of Ras protein signal transduction | BP |
GO:0016021 | integral to membrane | CC |
GO:0005125 | cytokine activity | MF |
GO:0045636 | positive regulation of melanocyte differentiation | BP |
GO:0070668 | positive regulation of mast cell proliferation | BP |
GO:0002763 | positive regulation of myeloid leukocyte differentiation | BP |
GO:0033026 | negative regulation of mast cell apoptosis | BP |
>gi|7305267|ref|NP_038626.1| kit ligand precursor [Mus musculus] MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEF FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPED SGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV |
Ensembl Gene |
ENSMUST00000105283 ENSMUST00000020129 |
---|---|
UniGene |
Mm.45124 |
PDB |
2O27 2O26 |
RefSeq |
NP_038626.1 |
Pfam |
PF02404 |