Text mining Term | cyclooxygenase 2 |
---|---|
UniProt ID | PGH2_RAT |
Name |
PGHS-2 Prostaglandin H2 synthase 2 Prostaglandin G/H synthase 2 Prostaglandin-endoperoxide synthase 2 Cyclooxygenase-2 PGH synthase 2 PHS II COX-2 |
Gene Names |
Ptgs2
|
Taxonomy | Rattus norvegicus |
Function |
Mediates the formation of prostaglandins from arachidonate. May have a role as a major mediator of inflammation and/or a role for prostanoid signaling in activity-dependent plasticity (By similarity). |
---|---|
Subcellular location |
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein. |
GO:0008289 | lipid binding | MF |
GO:0031622 | positive regulation of fever generation | BP |
GO:0090050 | positive regulation of cell migration involved in sprouting angiogenesis | BP |
GO:0030728 | ovulation | BP |
GO:0005635 | nuclear envelope | CC |
GO:0043065 | positive regulation of apoptotic process | BP |
GO:0020037 | heme binding | MF |
GO:0033280 | response to vitamin D | BP |
GO:0071260 | cellular response to mechanical stimulus | BP |
GO:0010042 | response to manganese ion | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0008285 | negative regulation of cell proliferation | BP |
GO:0071318 | cellular response to ATP | BP |
GO:0005789 | endoplasmic reticulum membrane | CC |
GO:0031915 | positive regulation of synaptic plasticity | BP |
GO:0007566 | embryo implantation | BP |
GO:0005792 | microsome | CC |
GO:0016702 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | MF |
GO:0048661 | positive regulation of smooth muscle cell proliferation | BP |
GO:0032227 | negative regulation of synaptic transmission, dopaminergic | BP |
GO:0014070 | response to organic cyclic compound | BP |
GO:0043234 | protein complex | CC |
GO:0045907 | positive regulation of vasoconstriction | BP |
GO:0030282 | bone mineralization | BP |
GO:0051926 | negative regulation of calcium ion transport | BP |
GO:0045986 | negative regulation of smooth muscle contraction | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0051968 | positive regulation of synaptic transmission, glutamatergic | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0004666 | prostaglandin-endoperoxide synthase activity | MF |
GO:0042493 | response to drug | BP |
GO:0032355 | response to estradiol stimulus | BP |
GO:0045987 | positive regulation of smooth muscle contraction | BP |
GO:0035148 | tube formation | BP |
GO:0009314 | response to radiation | BP |
GO:0009750 | response to fructose stimulus | BP |
GO:0046697 | decidualization | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0007613 | memory | BP |
GO:0004601 | peroxidase activity | MF |
GO:0051726 | regulation of cell cycle | BP |
GO:0010575 | positive regulation vascular endothelial growth factor production | BP |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | BP |
GO:0006979 | response to oxidative stress | BP |
GO:0010243 | response to organic nitrogen | BP |
GO:0071636 | positive regulation of transforming growth factor beta production | BP |
GO:0006954 | inflammatory response | BP |
GO:0090362 | positive regulation of platelet-derived growth factor production | BP |
GO:0090271 | positive regulation of fibroblast growth factor production | BP |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | BP |
>gi|148747270|ref|NP_058928.3| prostaglandin G/H synthase 2 precursor [Rattus norvegicus] MLFRAVLLCAALALSHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPT PNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPP VADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGTNMMFAFFAQHFTHQFFKTDQKRGPGFTRGL GHGVDLNHVYGETLDRQHKLRLFQDGKLKYQVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVFGL VPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE LLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRV AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYHDIDAMELY PALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFRIINTASIQSLICNNVKG CPFASFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL |
Ensembl Gene |
ENSRNOT00000003567 |
---|---|
UniGene |
Rn.44369 |
PDB | |
RefSeq |
NP_058928.3 |
Pfam |
PF03098 |